PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 223aa    MW: 23917.5 Da    PI: 6.3547
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11324genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY88.94.2e-28129186158
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
               +dDg++WrKYG+K vk+s++ r+YYrC+ +gC vkk+ver+++dp +v +tY g Hnh
  EMT11324 129 MDDGFRWRKYGKKAVKSSPNLRNYYRCSAEGCGVKKRVERDRDDPLYVLTTYDGVHNH 186
               59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.1E-29117188IPR003657WRKY domain
SuperFamilySSF1182909.29E-26121189IPR003657WRKY domain
PROSITE profilePS5081128.954124189IPR003657WRKY domain
SMARTSM007744.5E-32129188IPR003657WRKY domain
PfamPF031061.6E-22130186IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MAASLGLTTS HEAYYSAHPA ASSLYNFEAG DPFVAAADGA AELSFPELVE AARASDYSPL  60
PAFGAAGGET MNMYGRSVVF PMTASYYCDG AWMFEDDAAA RARGGGIGAM AGRPSGRIGF  120
RTRSEVEVMD DGFRWRKYGK KAVKSSPNLR NYYRCSAEGC GVKKRVERDR DDPLYVLTTY  180
DGVHNHVTPG STSSRAAPAY SAPTAPAWTW SELQAAAHSS ESY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25115189377Probable WRKY transcription factor 4
2lex_A2e-25115189377Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ7003270.0HQ700327.1 Triticum aestivum WRKY10 transcription factor (WRKY10) mRNA, complete cds.
GenBankKJ8307580.0KJ830758.1 Triticum aestivum WRKY10 transcription factor (WRKY10) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440727.11e-46hypothetical protein SORBIDRAFT_09g005700
TrEMBLM8BWY81e-163M8BWY8_AEGTA; Putative WRKY transcription factor 50
STRINGSb09g005700.14e-46(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.13e-38WRKY DNA-binding protein 50